CAMPUS DE BELLVITGE . ENSENYAMENT DE MEDICINA

DEPARTAMENT DE CIÈNCIES FISIOLÒGIQUES II

BIOFÍSICA I BIOLOGIA MOLECULAR (NIVELL CEL.LULAR)

QÜESTIONS I PROBLEMES
 
 
 
 

TEMA 1.- GENÈTICA MOLECULAR
 
 
 

Biosíntesi dels Nucleòtids

  1. Les cèl.lules normals es moren si es cultiven en un medi nutritiu que contingui timidina (desoxitimidina) i metotrexat. No obstant, aquest medi manté el creixement de cèl.lules mutants deficients en timidilat sintasa. Explica la raó d´aquests fets.
  2. Suposem que una cèl.lula A mutant no té timidina quinasa, un enzim que catalitza la fosforilació de la timidina a timidilat i que una altra cèl.lula B mutant no té activitat hipoxantina-guanina fosforribosil transferasa. Les cèl.lules A i B no creixen ni es divideixen en un medi que contingui hipoxantina, metotrexat i timina. No obstant, una cèl.lula C, formada experimentalment per la fusió de A i B, creix en aquest medi. Explica aquests fets.

  3.  

     

    Imaginem que volem introduir gens estranys en la cèl.lula A. Dissenya una manera senzilla de distingir les cèl.lules que han incorporat el gen estrany de les que no ho han fet.

  4. En el metabolisme dels nucleòtids es produeix dUTP que es hidrolitzat a dUMP per la dUTPasa. Les cèl.lules mutants que no tenen aquest enzim presenten fragments d´Okazaki anormalment petits quan són estimulades a replicar el seu DNA. Dóna una explicació d´aquest fet.
  5. La síntesi de novo del nucleòtid trifosfat ATP pot representar un cost energètic equivalent a 60-70 ATPs. Es això rentable per la cèl.lula?. .
  6. Aquest esquema correspon a una hipotètica via de biosíntesi dels nucleòtids de purines i pirimidines. Representa sobre l´esquema, utilitzant fletxes i símbols, un hipotètic sistema de regulació.
  7. Sobre el següents esquemes, marca amb colors diferents o amb un asterisc les vies de novo i amb un cercle les vies de recuperació de la biosíntesi dels nucleòtids de les bases púriques i pirimidíniques.

  8.  

     
     



    Replicació del DNA


  9. Aquesta figura correspon a un petit cromosoma eucariota lineal, amb un origen de replicació i en el que s´està produint la replicació del DNA.

  10.  

     

    Completa l´esquema representant a) els fragments d´okazaki , b) els cebadors, c) les diferents DNA polimerases, c) les helicases.

    Tenint en compte el mecanisme de replicació del DNA i les limitacions que té, quin problema planteja la replicació dels extrems dels cromosomes eucariotes?. Proposa o troba un mecanisme que resolgui aquest problema.

  11. La següent figura representa un esquema de la replicació del DNA en els eucariotes. Associa cada número de la figura a un dels elements de la llista que s´adjunta:-DNA polimerasa a -Fragment d´Okazaki -RNA cebador-Complex DNA polimerasa d - primasa -DNA helicasa -SSB (proteïnes d´unió a DNA monocatenari) -motlle de la cadena de creixement continu -motlle de la cadena de creixement discontinu

  12.  

     
     
     

  13. El genoma sencer de la mosca de la fruita, Drosophila melanogaster, està constituït per 1.65x108 parells de bases. Si la velocitat de replicació d'una sola forqueta es de 30 parell de bases s-1, calcula quant temps tardaria en replicar-se el genoma complet si la replicació s'inicia: a) en un únic origen bidireccional, b) en 2000 orígens bidireccionals. La replicació en les primeres fases dels embrions és uns 5-6 minuts més ràpida. Podria aquest temps de replicació estar justificat per l'existència de 16000 orígens?.

  14.  

     
     
     

  15. La figura representa la reacció d'elongació de la cadena de DNA, catalitzada per una DNA polimerasa. Fes un esquema equivalent en el cas de que la reacció es produís en direcció 3' a 5'.
  16. La desoxicordicepina 5´-trifosfat és un anàleg del dATP ( veure figura ). Aquesta substància es utilitzada com a substrat per les DNA polimerases. Què passaria si aquesta droga, incorporada a liposomes, fos administrada a cèl.lules en fase de replicació del DNA?.
  17. L'esquema representa una etapa de la replicació de la cadena de creixement discontinu. Representa amb un esquema com continuarà la replicació, indicant el tipus d'enzims que hi participen.

  18.  

     
     




    Reparació i recombinació del DNA


  19. L´esquema de la figura representa un mecanisme de reparació del DNA. Indica sobre la figura el tipus d´enzims i proteïnes que participen en les diferents etapes.
  20. L'esquema de la figura representa el mecanisme de reparació dels malaparallaments ("mismatch") de bases al DNA. Indica el tipus de proteïnes i/o enzims que participen en les cinc etapes de la reparació que es mostren a la figura.
  21. Les cèl.lules contenen sistemes de reparació del DNA que detecten la presència d´uracil en el DNA. Què passaria si hagués un sistema de reparació que per aminació convertís l´uracil en citosina?

  22.  

     
     




    Transcripció i processament del RNA. Traducció


  23. La distrofia muscular miotònica és una malaltia hereditària autosòmica dominant amb efectes multisistèmics que inclueixen debilitat muscular i problemes cardíacs. El gen afectat s'ha identificat, clonat i seqüenciat , estudiant-se quines són les alteracions presents en els individus afectats. Ara sabem que aquests malalts tenen una inserció de múltiples còpies d'un trinucleòtid de seqüència CTG i que el nombre d'aquests triplets està correlacionat amb la severitat de la malaltia. Aquesta inserció està localitzada en una regió no codificant a l'extrem 3' d'un gen que codifica una proteïna quinasa (Cell 68, 799-808, 21 febrer de 1992 ). Fa un temps va aparèixer un treball presentant els resultats de la figura.

  24.  

     

    Està alterada la seqüència de aminoàcids de la proteïna quinasa en els malalts?. Per què ? Com afecta la inserció als nivells de m-RNA i als nivells de la proteïna quinasa ? Formula una hipòtesi senzilla per explicar els resultats.
     
     
     
     

  25. La fludarabina ( fluoro- adenosina monofosfat ) es un fàrmac utilitzat en el tractament d´algunes leucèmies. Proposa un possible mecanisme d´acció.

  26.  

     
     
     

  27. La mitoxantrona és un fàrmac utilitzat en el tractament d´algunes leucèmies que té com a diana molecular una de les topoisomerases cel.lulars. Dona una possible explicació de la relació entre el mecanisme molecular i la seva eficàcia terapèutica.

  28.  

     
     
     
     
     

  29. La següent seqüència conté l´inici de transcripció d´un gen eucariota del que desconeixem l´orientació de les cadenes ( no utilitzar les convencions habituals )

  30.  

     

    GGCATAGTTCGGCGGGCTTTTCCAAAATCGCTTGCTTCGTGTTTATAGCGATATGGGTTCCAAATTTCTCGCCGGCGTGGTCGTTAC

    CCGTATCAAGCCGCCCGAAAAGGTTTTAGCGAACGAAGCACAAATATCGCTATACCCAAGGTTTAAAGAGCGGCCGCACCAGCAATG

    Dedueix la orientació de les cadenes i quina es la cadena motllo i quina la cadena codificant

    escriu, justificadament, la seqüència de les últimes 10 bases del transcrit primari corresponent al fragment. Explica el sentit de desplaçament de la RNA polimerasa durant la transcripció del gen
     
     
     
     

  31. L´ atàxia de Friedreich es l´atàxia hereditària més comú amb una incidència aproximada de 1/50.000 i una freqüència de portadors de 1/120 en la població europea. Es tracta de una malaltia autosòmica recessiva. Fa uns anys es va clonar el gen responsable (Science 271, 1375, 8 de Març de 1996). La seqüència del gen dels pacients demostra la presència de múltiples copies del triplet GAA en el intró 1 del gen.

  32.  

     

    Fes esquemes molt simples del gen normal i del gen mutat.

    Formula una hipòtesi senzilla per a explicar les dades, comentant com estarien afectats els nivells de missatger, i la seqüència i els nivells de la proteïna codificada.

  33. S'ha demostrat que mutacions en el gen APC juguen un paper en el desenvolupament de càncer de còlon (Nature 359,235, 17 de setembre de 1992). La taula adjunta resumeix les mutacions detectades en alguns pacients amb càncer de còlon.

  34.  

     

    Normal Mutat

    pacient 1 CGA TGA (codó 564)

    pacient 2 AAA AA (codó 758)

    pacient 3 ATA AATA (codó 1307)

    pacient 4 TCT TAT (codó 906)

    Com estarà afectada la proteïna d'aquests pacients en quant al nombre i a la seqüència

    d'aminoàcids ?.

    (nombre total d'aminoàcids de la proteïna normal = 1500)

  35. La següent seqüència de DNA correspon a un petit gen eucariota que no conté introns i que codifica un polipèptid de 12 aminoàcids.

  36.  

     

    Dedueix quina és la cadena codificant. Determina la seqüència del polipèptid

    AATGTGATGGGTACTTATTAAGACAGCACTAATCTTGCGCCACGCTTAAGATGCATGGCGCGCCGTAC

    TTACACTACCCATGAATAATTCTGTCGTGATTAGAACGCGGTGCGAATTCTACGTACCGCGCGGCATG
     
     

  37. Un gen que codifica per un enzim experimenta una mutació per la que es substitueix una base per una altre. Indica en quin punt o regió del gen hauria de tenir lloc la mutació per produir cada una de les conseqüències següents: L'enzim conté un nombre més gran d'aminoàcids
    1. L'enzim conté el mateix nombre d'aminoàcids però és inactiva
    2. No hi ha transcripció del gen
    3. Hi ha transcripció del gen però no hi ha traducció
    4. L'enzim conté un nombre més petit d'aminoàcids
    5. L'enzim conté el mateix nombre d'aminoàcids i la mateixa seqüència
    6. Hi ha un augment de la transcripció del gen
    7. La mutació no afecta a la seqüència d'aminoàcids però el mRNA és més gran
    8. el mRNA és més petit sense estar afectada la seqüència d´aminoàcids
    9. hi ha un augment en els nivells de m-RNA sense afectar-se la velocitat de transcripció del gen
  1. Quasi el 50% de la població mundial adulta presenta intolerància a la llet. Aquesta intolerància és hereditària i és deguda a que les cèl.lules del intestí no tenen activitat lactasa, enzim que digereix el sucre de la llet, la lactosa. No obstant, aquestes mateixes persones durant l´ època de lactància ( 0-1 any ) no han tingut cap problema i per tant no varen presentar intolerància a la llet. Raona en quina regió del gen que codifica per la lactasa creus que podria haver-se produït una mutació que expliqués aquesta intolerància. Quin tipus d´herència creus que és: dominant o recessiva ?.

  2.  

     
     
     

  3. En una malaltia genètica s´han trobat alteracions en el gen que codifica una proteïna determinada. Les seqüències d´aminoàcids corresponents a un individu normal i a un individu afectat per aquesta malaltia són:

  4.  

     

    normal -gly-tyr-thr-ala-lys-ser-pro-ser-leu-asn-ala-ala-leu-

    afectat -gly-tyr-thr-ala-lys-val-his-his-leu-met-ala-ala-leu-

    Explica aquests canvis en la seqüència d´aminoàcids amb només dues mutacions puntuals (substitucions, insercions o deleccions d´un sol parell de bases).

    Dedueix la seqüència de bases dels mRNA corresponents

  5. RET és un receptor amb activitat proteïna tirosina quinasa. S´han descrit diferents mutacions del gen que codifica aquest receptor en el càncer de tiroides i en la síndrome de Hirschsprung ( una malaltia hereditària dominant caracteritzada per l´absència d´ inervació parasimpàtica en el tracte intestinal baix). Algunes d´aquestes mutacions estan resumides a la taula. La Figura mostra un esquema del gen. ( CD: regió tipus caderina; Cys: regió d´unió del lligand ric en cisteïnes; TM, regió transmembranal; TK, dominis tirosina quinasa ).( Nombre total de codons de RET : 1114 )

  6.  

     
     
     
     
     
     
     
    Càncer de Tiroides Cas 1 TGT ® GGT ( Codó 619 ) ( exó 10 ) Cas 2 TGC ® CGC ( codó 635 ) ( exó 11 )

    Cas 3 TGT ® CGT ( codó 621 ) ( exó 10 )

    Cas 4 TGC ® TGG ( codó 612 ) ( exó 10 )

    Síndrome de Hirschsprung Cas 5 GAA ® TAA ( Codó 136 ) ( exó 3 ) Cas 6 AGA ® TGA ( codó 180 ) ( exó 3 )

    Cas 7 TCA ® TTA ( codó 32 ) ( exó 2 )

    Cas 8 CGA ® GGA ( codó 972 ) ( exó 17 ) 


     

    Com estan alterats el nombre i la seqüència d´aminoàcids en cada cas ?

    Com podria estar afectada la funció de RET en cada cas?
     
     
     
     
     
     

  7. Raona, d' acord amb les regles del balanceig, les seqüències del mínim nombre d'anticodons que es necessitarien per reconèixer els codons de cisteïna i triptofan.
  8. Quins aminoàcids i quins codons podrien ser reconeguts per aquests dos anticodons de dos t-RNA: IGC i UGA ?
  9. Un tRNA de cisteïna carregat amb l´aminoàcid cisteïna es modifica químicament de forma que la cisteïna es convertida a Alanina. Raona quins codons podrien ser reconeguts per aquest nou AA-tRNA.
  10. En la síntesi de proteïnes no existeix un sistema tipus de "correcció de proves" de les DNA polimerases, un cop format l'enllaç peptídic, en la reacció catalitzada per la peptidil-transferasa Per que ?.
  11. L'esquema representa un fragment de la cadena codificant del gen d´una proteïna i conté l´ínici de la traducció. Dedueix la seqüència del fragment de mRNA corresponent. Dedueix la seqüència d´aminoàcids. Proposa dues mutacions d´una sola base en dos codons diferents que impedeixin la síntesi de la proteïna.

  12.  

     
     

    Tècniques d´investigació i manipulació del genoma. Teràpia gènica

  13. La següent figura correspon a un gel de seqüenciació de DNA, fet pel mètode del didesoxinucleòtid (Sanger), d'un fragment de la cadena no codificant de l'exó 5 del gen de la lipoproteïna lipasa. Es compara la seqüència d'una persona normal amb la d'un malalt que presenta deficiència d'activitat lipoproteïna lipasa.

  14.  

     

    a)Dedueix la seqüència d' aminoàcids corresponent a aquest fragment sabent que la proteïna normal i la del malalt tenen el mateix nombre d' aminoàcids.

    b)Estarien afectats els nivells de mRNA i de la proteïna en el malalt ?.

  15. El plàsmid problema de la figura conté un fragment de DNA genòmic corresponent a un gen que s´ha insertat en la diana ùnica de restricció EcoRI. Per investigar la proteïna codificada pel gen es seqüència el DNA del fragment pel mètode didesoxi. A partir de les dades de l´ enunciat i de la figura representa un gel de seqüènciació de DNA amb les 10 primeres bandes que s´obtindrien al seqüenciar el DNA corresponent al fragment genòmic.

  16.  

     

    Dedueix la seqüència d´aminoàcids codificada pel fragment genòmic sabent que conté els 10 aminoàcids de l´extrem carboxiterminal.

    Com es podria preparar una sonda a partir del plàsmid per detectar el mRNA present en els diferents teixits ?

    Representa el patró de bandes electroforètiques resultant de la digestió del plàsmid amb XbaI, indicant el pes molecular aproximat dels fragments.

    Representa el patró de bandes electroforètiques resultant d´una digestió doble amb XbaI i PstI en el cas de que XbaI funcioni correctament però PstI falli i produeixi digestions parcials. Indica el pes molecular aproximat dels fragments.
     
     

  17. S'han detectat les 4 mutacions següents en el gen de la fibrosi quística:

  18.  

     

    506 507 508 509 510

    ATC ATC TTT GGT GGT ® ATCATCGGTGGT

    541 542 543 544

    CTT GGA GAA GGT ® CTTTGAGAAGGT

    346 347 348 349

    CTG CGC ATG GCG ® CTGCCCATGGCG

    506 507 508 509 510

    ATC ATC TTT GGT GTT ® ATCTCTTTGGTGTT

    (nombre total d´aminoàcids: 1480)

    Raona com estarà afectada la proteïna de cada un d´aquests pacients en quant al nombre i a la seqüència d´aminoàcids.

    Raona quina/quines d´aquestes tres tècniques podrien ésser utilitzades per diagnosticar la malaltia en cada un dels 4 casos: 1. seqüènciació del cDNA corresponent, 2. electroforesi de proteïnes en SDS/poliacrilamida, 3. amplificació per P.C.R. del fragment que conté la mutació i anàlisi del tamany per electroforesi en gel de poliacrilamida. 4. amplificació per P.C.R. del fragment que conté la mutació i anàlisi del tamany per electroforesi en gel de agarosa.
     
     

  19. Els càncers amb mutacions en gens que codifiquen proteïnes implicades en la reparació dels malaparellaments ("missmatch") tenen una inestabilitat genòmica exagerada, denominada fenotip mutador de microsatèlits. Fa uns anys, l´equip dirigit per l´investigador espanyol Manuel Perucho ha descobert que més del 50 % dels adenocarcinomes de colon amb fenotip mutador de microsatelits tenen mutacions en el gen BAX, que codifica per una proteïna inductora d´apoptosi. La figura correspon a la seqüenciació dels codons 36-44 del gen BAX prèviament amplificada per PCR d´un teixit normal ( N ) i dos tumors ( T1 i T2 ).

  20.  

     

    Quina conseqüència tenen les mutacions detectades en la funció de la proteïna BAX?

    Com estaran afectats els nivells de mRNA i de proteïna BAX en els tumors ?

    Quina podria ser la relació entre aquestes mutacions del gen BAX i el càncer de colon?

    Enumera una tècnica addicional que es podria utilitzar per saber si BAX presenta aquestes mutacions
     
     
     
     

  21. Un investigador ha seqüenciat una de les cadenes d'un fragment d'un cDNA. Aquest fragment conté l'inici de traducció. La seqüència és la següent:

  22.  

     

    G C C A T G C T T T A G A A G C A T

    Dedueix la seqüència d'aminoàcids codificada pel fragment de cDNA, raonant la resposta.

  23. Amb objecte d'estudiar la regulació de l'expressió del gen que codifica un enzim es va procedir al clonatge del cDNA corresponent al seu missatger. Utilitzant una genoteca de fag lambda es va aïllar un clon de cDNA amb el tamany i dianes de restricció representats a la figura. Per obtenir quantitats importants del cDNA amb objecte de realitzar estudis posteriors, aquest cDNA es va subclonar en el vector plasmídic Bluescript (2,9 kb de tamany, Figura ), es va introduir en E.coli i es va preparar un cultiu bacterià líquid. A partir d'aquest cultiu s'ha purificat el plàsmid i s'han fet diferents digestions amb enzims de restricció per tal de caracteritzar el nou clon plasmídic i averiguar quina es l'orientació del cDNA subclonat. La Figura representa una anàlisi electroforètica de la preparació del plàsmid recombinant i de les diferents digestions.

  24.  

     

    Esquematitza el procés seguit per subclonar el cDNA en el plàsmid bluescript.

    Explica les diferències que s'observen als carrils 1 i 3 respecte als carrils 2 i 4

    Raona quina és l'orientació del fragment del cDNA subclonat al plàsmid bluescript.

    Carrils electroforètics:

    0: marcadors de pes molecular

    1: preparació de DNA del plàsmid bluescript

    2: DNA de plàsmid bluescript digerit amb BamHI

    3: preparació de DNA del plàsmid bluescript en el que s'ha subclonat el cDNA

    4: DNA del plàsmid recombinant digerit amb BamHI

    5: DNA del plàsmid recombinant digerit amb SacI

  25. Un gen que es vol estudiar pot originar per splicing alternatiu els mRNAs A i B de la figura. Al laboratori disposem dels cDNAs corresponents als dos mRNAs, subclonats en els plàsmids que es mostren. Raona un procediment tècnic per identificar els dos plàsmids en el suposat teòric de que s'hagués perdut la rotulació dels tubs. Explica quin patró de bandes cal esperar al analitzar els productes de la digestió de cada plàsmid amb l´enzim EcoRI. Explica com prepararies a partir dels plàsmids una sonda de DNA capaç de detectar específicament el mRNA B en mostres biològiques.
  26. Un laboratori ens ha enviat un plàsmid ( Figura ) que conté el cDNA d´un gen que volem utilitzar per estudis biològics. Coneixent el mapa de restricció realitzem una sèrie de digestions per assegurar la identitat del plàsmid. Es realitzen una digestió amb EcoRI i dos digestions dobles amb EcoRI/PstI i XbaI/HindIII i s´analitzen els fragments obtinguts per electroforesi en gel d´agarosa. Indentifica la digestió que correspon a cada carril de la figura 1. En el cas de que utilitzessis com a sonda el fragment de 1.5 kb del plàsmid, explica quins fragments de la electroforesi hibridarien amb aquesta sonda en un experiment de Southern Blot Explica dos possibles experiments per detectar l´expressió en differents teixits del gen que estem estudiant.
  27. S´ha aïllat el gen X humà a partir d´una genoteca de fag lambda. Es disposa d´un clon amb el gen X subclonat en la diana EcoRI d´un plàsmid ( Figura ). Es vol expressar la proteïna en bacteris per produir-la en gran quantitat. Es podria utilitzar el plásmid de la figura per expressar la proteïna en bacteris ?.
Com es podria preparar una sonda a partir del plàsmid per detectar el mRNA en els diferents

teixits ?

Quin tipus de manipulacions genètiques hauríem de fer en el gen X per que al introduir-lo en cèl.lules en cultiu fos induït per una hormona que té un receptor acoblat a una proteïna G que activa

L´adenilaticlasa
 
 

TEMA II. METABOLISME ENERGÈTIC CEL.LULAR
 
 

Glicolisi i via de les pentoses

46.- El iodoacetat inhibeix la glicolisi al inactivar la gliceraldehid-3-P deshidrogenasa. En aquestes condicions s´acumula fructosa 1,6-bisfosfat. Raona per què es deu acumular aquest metabolit i no d´altres.
 
Reacció gliceraldehid 3-P deshidrogenasa D Go´= + 1.5 Kcal/mol D G en condicions intracel.lulars = -0.4 Kcal/mol
Reacció Triosa-fosfat isomerasa D Go´= +1.8 D /mol D G en condicions intracel.lulars = +0.6 Kcal/mol
Reacció Fosfofructoquinasa D Go´= -3.4 Kcal/mol D G en condicions intracel.lulars = -5.3 Kcal/mol
Reacció aldolasa D Go´= + 5.7 Kcal/mol D G en condicions intracel.lulars = -0.3 Kcal/mol

  1. Fibroblastes humans són irradiats amb llum Ultraviolada per tal d´obtenir mutants a l´atzar. S´obtenen 2 línies cel.lulars mutants que presenten alteracions en gens d´enzims de la glucòlisi. Les conseqüències són les següents:

  2.  

     

    Línia 1: Muta el gen que codifica la fosfoglucosa isomerasa, donant un enzim inactiu

    Línia 2: Apareix una forma mutant inactiva de la enolasa

    Raona les possibles conseqüències de cada mutació, explica la major o menor gravetat per la cèl.lula i la forma en que podrien compensarse.
     
     

  3. L´esquema de la figura .correspon a la via de Etner-Doudoroff, una fermentació alcohòlica. Fes el balanç d´aquesta via.
  4. Les següents figures correspon a un estudi cinètic de la fosfofructoquinasa glicolítica (PFK-1), a) a concentració constant d´ATP i b) a concentració constant de fructosa 6-P. Comenta els resultats que s´observen i en relació al control de la glicolisi
  5. Fes el balanç de la via de les pentoses funcionant segons els esquemes representats i calcula quin percentatge dels carbonis de la glucosa es metabolitzen a través de la branca oxidativa
  6. Escriu el balanç ajustat de la conversió de glucosa en PRPP a través de la branca oxidativa de la via de les pentoses.

  7.  

     
     
     

  8. Fes el balanç de l´utilització de la Xilulosa per produir NADPH a través de la via de les pentoses funcionant segons el següent esquema i calcula quin percentatge dels carbonis de la xilulosa es metabolitzen a través de l´intermediari fructosa 1,6-P2
  9. Fes el balanç de la conversió de ribosa 5-fosfat en glucosa i calcula quin percentatge dels carbonis de la ribosa 5-P es converteixen en fructosa 6-P a través de l'intermediari Fructosa 1,6-P2 .
  10. Una línia cel.lular es cultiva al laboratori en condicions anaeròbiques i utilitzant com a font d´energia la ribosa. Fés el balanç de la metabolització de la ribosa per a la obtenció d´energia en aquestes condicions . Calcula el nombre d´ATPs formats per carboni de ribosa metabolitzat i el percentatge dels carbonis de la ribosa que es metabolitzen a través de la dihidroxiacetona-P.
  11. Una línia cel.lular es cultiva al laboratori en condicions aeròbiques i utilitzant com a font d´energia la ribosa. Fés el balanç de la metabolització de la ribosa per a la obtenció d´energia en aquestes condicions, fins a CO2 i nucleòtids reduïts ( NADH i FADH2 ). Calcula el nombre d´ATPs formats per fosforilacions a nivell de substrat i el percentatge dels carbonis de la ribosa que es metabolitzen a través de la dihidroxiacetona-P.
  12. La fructosa posseeix una via pròpia de metabolització al fetge ( figura ). Fes el balanç de la conversió més eficient ( màxim nombre de carbonis convertits ) de la fructosa en ribosa i calcula quin percentatge dels carbonis metabolitzats ho fan a través de l´intermediari fructosa 1,6-P2 i quin és el cost energètic ( enllaços d´alta energia / C de fructosa transformat ).
  13. Què produeix més ATP, la oxidació de 5 molècules de glucosa-6-P o de 6 molècules de

  14.  

     

    ribosa-5-P?
     
     

    Oxidació del àcids grassos i Cicle Oxidatiu Tricarboxilic


  15. Dels següents processos que tenen lloc al cicle oxidatiu tricarboxílic assenyala els que són favorables i els que són desfavorables en termes energètics: 1. reducció del NAD , 2. Síntesi de GTP, 3. Deshidrogenació, 4. Formació del enllaç tioester del succinil-CoA, 5. Síntesi de citrat, 6. Reducció del FAD, 7. Trencament del enllaç del succinil-CoA, 8. Descarboxilació.
  16. Què produiria més ATP, la ß-oxidació mitocondrial de 255 g de palmitat o de 286 g de octanoat?. Palmitat: CH3-(CH2)14-COO-

  17.  

     

    Octanoat: CH3-(CH2)6-COO-

  18. Calcula el nombre d´ATPs produïts per l´oxidació mitocondrial completa a CO2 i H2O d´un àcid gras saturat de 15 carbonis. ( equivalències energètiques =2.5 ATP/NADH;1.5 ATP/FADH2 )

  19.  

     

    (Informació addicional: ß-oxidació, COT)
     
     
     
     

  20. Una molècula de palmitat (CH2-[CH2]14-COO-) marcada totalment amb triti (3H) s' oxida completament a acetil-CoA en presencia d' un extracte mitocondrial (extracte mitocondrial : preparat biològic que conté tots els enzims i cofactors mitocondrials). L'acetil-coA produit és hidrolitzat a acetat lliure. Raona quina serà la relació triti/carboni dels acetats produïts.
  21. Quantes insaturacions hauria de tenir un acil-coA de n carbonis per a que la seva oxidació mitocondrial completa produís menys ATP que un acil-coA saturat de n-2 carbonis?. .
  22. En la següent figura es representa el cicle del glioxilat.

  23.  

     

    Fes el balanç material d´aquest cicle.

    Algunes cèl.lules que contenen els enzims d´aquest cicle poden créixer en presencia d´ acetat com a única font de carboni. Explica com és això possible.

    Per què això no és possible en el cas del cicle de Krebs?

  24. Els camells del desert produeixen una gran quantitat d´aigua al oxidar el greix de les seves gepes (10.7 litres per kg de greix). Enumera els processos que produeixen i consumeixen aigua que s´haurien de tenir en compte per obtenir aquest balanç.
  25. Quin és el rendiment en ATPs quan s´oxida completament a CO2 cada un dels substrats següents en presència d´un homogenat cel.lular?. (homogenat cel.lular: preparat biològic que conté tots els enzims i cofactors cel.lulars).
  1. piruvat, b) NADH, c) Fructosa- 1,6-P2, d) fosfoenolpiruvat, e) glucosa, f) dihidroxiacetona fosfat.
  1. La degradació dels triglicèrids permet la conversió parcial d´alguns carbonis en ribosa.

  2.  

     

    Fes el balanç material de la conversió del tripalmitoil glicerol en ribosa, justificant la resposta

    Calcula quin pecentatge dels carbonis metabolitzats ho fan a través de l´intermediari fructosa 1,6-P2

    Calcula quin percentatge dels carbonis metabolitzats ho fan a través de la branca oxidativa de la via de les pentoses.

  3. Afegim piruvat ( CH3-CO-COO- )marcat amb 14C en posició 3 a mitocondris aïllats.

  4.  

     

    Raona quina serà la posició del 14C en l´ oxalacetat després d´una volta del C.O.T.

  5. Imagina dues cèl.lules que experimenten mutacions que porten als següents defectes enzimàtics: piruvat deshidrogenasa en un cas i isocitrat deshidrogenasa en l´altre. Quina de les dues situacions consideres que seria mes greu per la cèl.lula ?.

  6.  

     
     

    Cadena Respiratòria Mitocondrial i fosforilació oxidativa

  7. Disposem de l´artefacte experimental mostrat a la Figura A per estudiar el funcionament del metabolisme energètic mitocondrial. Suposem que els mitocondris disposen de NADH. Explica els resultats obtinguts a la Figura B al utilitzar el sistema experimental de la Figura A.

  8.  

     
     
     

  9. La rotenona, l´antimicina i el dinitrofenol són substàncies que interfereixen amb la cadena respiratòria mitocondrial i la fosforilació oxidativa, tal com s´esquematitza a la figura. Relaciona raonadament cada una d´aquestes substàncies amb un dels següents efectes: a) impossibilitat d´oxidar succinat i piruvat, b) impossibilitat d´oxidar piruvat però no succinat, c) augment de la producció de calor.
  10. La nigericina és un ionòfor que intercanvia K+ per H+ a través de les membranes. la rotenona és una substància que bloqueja el complex I de la C.R.M. Raona els efectes de les dues substàncies sobre el transport d´electrons i la síntesi d´ATP.
  11. El cianur és un potent verí que actua bloquejant la transferència d´electrons des del citocrom c a l´oxigen. Explica raonadament quin seria l´efecte d´aquest compost sobre el gradient de protons format entre l´ espai intermembranós i la matriu mitocondrial. Com s´explica que aquest verí provoqui un increment de l´activitat de la fosfofructoquinasa de la via glicolítica (PFK-1)?
  12. Disposem al laboratori d´un tub que conté una suspensió de mitocondris intactes i funcionals. Al mesurar el metabolisme aerobi determinem que la suspensió consumeix uns 12 nanomols d´O2 per minut. Si suposem que el C.O.T es la única via aeròbia funcionant, raona quants mols d´acetil-CoA poden oxidar-se com a màxim per minut.

  13.  

     
     


    TEMA 3 . ESTRUCTURA I METABOLISME DE LES MEMBRANES.

  14. La seqüència d'aminoàcids d'un fragment de la proteïna causant de la fibrosi quística (CFTR) es la següent:

  15.  

     
     

    STRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECLFDDMESI 840

    PAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRN 900

    NSYAVIITSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLH 954

    La seqüència d'aquest fragment suggereix que es tracta d'una proteïna integral i conté dos probables dominis transmembranals. Localitza aproximadament les dues seqüències que corresponen als dominis transmembranals del fragment. Justifica l'elecció.

    La seqüència d'aminoàcids també suggereix que es tracta d'una glicoproteïna.

    Per què ?.

    De la seqüència també es dedueix que la funció d'aquesta proteïna pot ser regulada por fosforilació, en resposta a augments de la concentració intracel.lular de AMP cíclic. Què hauries de conèixer per poder fer aquesta afirmació ?.

    Raona i fes un esquema que representi l'orientació més probable d'aquesta proteïna respecte a la membrana cel.lular.

  16. Les seqüències següents corresponen a dos dominis de dues glicoproteïnes.

  17.  

     

    *

    Proteïna 1 ......VLRGGSRRIFVLIWCLVIFLAVVAALLVVTQTYKANSTGGD.......

    Proteïna 2 .....RVHNATGGKRSTGAAKFEKKALLSRTYYPDVNTTHLLKH .......

    La serina marcada amb un asterisc es fosforilada per una proteïna quinasa.

    La seqüència consens de N-glicosilació es: Asn-X-Ser/Thr

    Dibuixa un esquema on s´indiqui la possible interacció i orientació en relació a la membrana d´aquests dominis.

  18. Per què la mobilitat dels lípids en els liposomas és més gran que la dels lípids de les membranes biològiques ?.
  19. Els detergents iònics (v.g. Dodecil Sulfat) i no iònics (v.g. octil glucòsid) poden solubilitzar proteïnes de membrana. Si volguessis preservar l'activitat enzimàtica d'una proteïna de membrana un cop solubilitzada, quin tipus de detergent utilitzaries i per què ?.
  20. Raona el sentit fisiològic dels canvis observats en la composició d'àcids grassos de la membrana de les cèl.lules de E. coli cultivades a diferents temperatures indicats a la figura.
  21. L'esquema representa la distribució asimètrica de diverses proteïnes respecte a la membrana plasmàtica. Indica i raona quins serien els costats intra i extracel.lular.
  22. Un liposoma està constituït per un únic tipus de fosfolípid que conté 2 àcids grassos de 18 carbonis monoinsaturats. Es fa un estudi per investigar la influència de l´estructura dels àcids grassos del fosfolípid sobre la temperatura de transició gel-fluid del liposoma i s´obtenen els resultats de la figura. Comenta breument els resultats de la gràfica i dona una explicació de les dades obtingudes.
  23. Comenta molt breument les dades de la figura i proposa mecanismes que expliquin aquestes dades.
  24. A partir dels següents precursors, esquematitza una via de biosíntesi del fosfatidil-inositol:

  25.  

     

    -ATP-Inositol-CTP-Acids grassos-CoA-Glicerol-3-fosfat

  26. A partir dels següents precursors, esquematitza dues possibles vies de biosíntesi de esfingomielina: ATP, CTP, Àcids grassos, CoA, colina, fosfatidilcolina, esfingosina
  27. Sobre la figura indica l´acció de les diferents fosfolipases i explica en quins casos s´alliberen segons missatgers.

  28.  

     
     




    TEMA IV. TRANSPORT A TRAVÉS DE MEMBRANES


  29. Una dissolució de glucosa en aigua presenta una zona d'alta concentració (a l'esquerra) i una zona de baixa concentració (a la dreta). Considerant que les dues zones tenen el mateix volum, dibuixeu el perfil de concentració, el gradent de concentració i el flux en el temps inicial (ti), quan s'arribi a l'equilibri (tf) i en un temps intermig (t).

  30.  

     

    ti t tf


     
     

  31. Calculeu el temps mitjà que triga (20o C) en desplaçar-se per difusió: a) una molècula d'urea el radi d'un glòbul vermell (7 m m), b) una molècula d'O2 el radi d'un alveol pulmonar (100 m m), c) una molècula d'O2 el radi d'un capil.lar sanguini (5 m m), d) un ió de Na+ la longitud de 0.5 m de l'axó d'una cèl.lula nerviosa, e) una molècula d'acetilcolina (D= 5 · 10-6 cm2/s) el gruix d'una fisura sinàptica (50 nm). A partir dels resultats obtinguts discutiu en quines situacions la difusió pot ser un procés eficient de transport.

  32.  

     

    Solució: a) 6.8 ms, b) 88 m s, c) 4.2 ms, d) 371 dies, e) 0.83 m s.

  33. Calculeu el flux de difusió (20o C) de Cl- a través d'una bicapa lipídica de 10 nm de gruix que separa dues dissolucions 100 mM i 10 mM.

  34.  

     

    Solució: 8.1 · 10 -13 mol cm-2 s-1.

  35. Una bicapa lipídica de 10 nm de gruix i permeable a l'urea (coeficient de partició K=0.0002) separa dues dissolucions d'urea en aigua (20o C) amb concentracions de 12 g/l i 6 g/l. Calculeu el flux d'urea.

  36.  

     

    Solució: 6 · 10 -8 g cm -2 s -1.

  37. Una membrana porosa de 10 nm de gruix separa dues dissolucions de glucosa en aigua (20o C) de 10 g/l i 5 g/l. L'àrea de la membrana és 1.5 cm2 i els porus constitueixen el 5% de la superfície total de la membrana. Calculeu: a) el flux de glucosa a través de la membrana, i b) el temps requerit perquè travessi la membrana 1 mmol de glucosa.

  38.  

     

    Solució: a) 1.67 mg cm -2 s -1, b) 72 s.

  39. Una bicapa lipídica de 10 nm de gruix separa una dissolució (20o C) d'urea 0.1 M d'una altra 1M. Calculeu el canvi d'energia lliure de Gibbs al transportar 0.1 mol d'urea des de: a) el compartiment 0.1 M al 1 M, b) el compartiment 1 M al 0.1 M.

  40.  

     

    Solució: a) 560 J, b) -560 J.

  41. Una membrana porosa en la que els porus tenen un diàmetre d'1 nm, separa dues dissolucions (20o C), A i B, de concentracions 1 mM i 1 mM respectivament. El tamany de les partícules de solut de la dissolució A és de 0.5 nm i el de la dissolució B 1.5 nm. Calculeu la diferència de pressió osmòtica a través de la membrana. Discutiu la cinètica del procés.

  42.  

     
     
     

  43. Descriviu els efectes osmòtics que tenen lloc a l'introduir glòbuls vermells obtinguts d'una mostra de sang ( p de l’eritròcit = 0.3 Osm) en les següents solucions: a) 0.3 M de sacarosa, b) 0.15 M de NaCl, c) 0.3 M d'urea, d) 0.4 M de sacarosa, e) 0.3 M de sacarosa+ 0.1 M d'urea, f) aigua destil.lada. Discutiu la cinètica del procés. ( Aquí estem suposant que la membrana de l’eritròcit no permet el pas de la sacarosa, de Na+ i de Cl- ).
  44. La pressió sanguínia a l'extrem arterial d'un capil·lar és 25 mm Hg, la pressió a l'extrem venós és 10 mm Hg, la pressió osmòtica del fluid intersticial és 5 mm Hg, la pressió osmòtica sanguínia 28 mm Hg i la pressió del fluid intersticial -6 mm Hg. Calculeu el flux de filtració, el flux osmòtic i el flux net d'aigua: a) a l'extrem arterial i b) a l'extrem venós del capil·lar.

  45.  

     

    Solució: a) 2.86 · 10 -7 cm/s, 2.12 · 10 -7 cm/s, 0.74 · 10 -7 cm/s: b) 1.47 · 10 -7 cm/s,

    2.12 · 10 -7 cm/s, 0.64 · 10 -7 cm/s.

  46. La figura mostra les concentracions intra i extracel.lulars d'una cèl.lula (20o C) que té un potencial de membrana de -70 mV. a) Dibuixeu el sentit del camp elèctric, b) el sentit i les magnituds relatives dels fluxos elèctric, de difusió, d'electrodifusió i de bombeig per cadascun dels ions, c) calculeu el treball necessari per bombar un m mol de cada ió, d) com es modifiquen els resultats si el potencial de membrana canvia a -80 mV?, e) com es modifiquen els resultats si el potencial de membrana canvia a -60 mV?.

  47.  

     


     
     

    Coeficient de difusió D (cm2/s) en aire a 1 atm i 20o C:

    N2 0.18

    O2 0.19

    CO2 0.10

    H2O vapor 0.24

    Coeficient de difusió D (cm2/s) en aigua a 20o C:

    N2 1.1 · 10-5

    O2 1.0 · 10-5

    CO2 0.9 · 10-5

    urea 1.2 · 10-5

    glucosa 6.7 · 10-6

    hemoglobina 6.9 · 10-7

    DNA 1.3 · 10-8

    Na+ 1.3 · 10-5

    K+ 1.9 · 10-5

    Cl- 2.0 · 10-5

    Ca++ 0.8 · 10-5

    Permeabilitat P (cm/s) d’una bicapa lipídica sintètica de 10 nm de gruix a 20o C:

    H2O 8 · 10-3

    urea 1 · 10-5

    glucosa 5 · 10-8

    Na+ 1 · 10-12

    K+ 3 · 10-12

    Cl- 9 · 10-9

    Permeabilitat P (cm/s) de capil·lars sanguinis en múscul esquelètic humà a 37o C:

    insulina 9 · 10-7

    urea 1 · 10-5

    glucosa 1.3 · 10-5

    sacarosa 0.9 · 10-5

    Coeficient de filtració Lp (cm s -1 atm -1) d'aigua a 37o C:

    eritròcits humans 9 · 10-6

    capil.lar sanguini en múscul esquelètic humà 7 · 10-6
     
     
     
     

  48. En les següents figures es representen els principals sistemes de transport presents a les cèl.lules epitelials de la mucosa de l´estómac i de l´intestí. Indica les caracteristíques per cada transportador assenyalat a la figura (actiu, passiu, cotransport, simport, antiport, uniport, actiu primari, actiu secundari, bomba de ions, canal iònic, difussió simple, etc).
  49. En la següent figura es representen alguns dels principals sistemes de transport de ions presents a les fibres cardíaques. La digitoxigenina es inhibidor de la bomba de sodi molt utilitzat en malalts amb insuficiència cardíaca. Explica per qué la digitoxigenina augmenta la contractibilitat calci-dependent de la fibra cardíaca.
  50. La conductància d´una membrana lipídica que conté un ionòfor disminueix bruscament quant la temperatura baixa de 40 a 361C. Raona quin dels dos tipus de ionòfor de la figura es correspon millor amb les dades de la pregunta.

  51.  

     

    97bis. La següent figura representa el funcionament d´un canal iònic d´un axó controlat per voltatge. Comenta la figura indicant: a) la orientació del canal respecte als medis extra i intracel.lular, b) el seu mecanisme d´apertura i c) el seu mecanisme de control.
     
     
     
     

    TEMA V.PROPIETATS ELÈCTRIQUES DE LES MEMBRANES CEL.LULARS

  52. Una membrana separa dues dissolucions de NaCl de concentracions 150 mM i 15 mM. Si la temperatura és de 20o C i la membrana és permeable al Na+ i impermeable al Cl- i a la glucosa: a) calculeu el potencial de difusió, b) indiqueu el sentit dels fluxos elèctric, de difusió i d'electrodifusió del Na+, c) quina quantitat de glucosa caldria afegir a una de les dues dissolucions per tenir la mateixa pressió osmòtica.

  53.  

     

    Solució: a) 58 mV, c) 270 mmol/l.

  54. Repetiu el problema anterior si la membrana és permeable al Cl- i impermeable al Na+ i a la glucosa.

  55.  

     

    Solució: a) -58 mV, c) 270 mmol/l.

  56. Una membrana separa dues dissolucions de NaCl de concentracions 150 mM i 15 mM. Si la temperatura és de 20o C i les permeabilitats del Na+ i del Cl- són iguals i de valor 10-9 m/s, calculeu el potencial de difusió. Discutiu la cinètica del procés.

  57.  

     

    Solució: 0 mV.

  58. Una membrana separa dues dissolucions de NaCl de concentracions 150 mM i 15 mM. Si la temperatura és de 20o i les permeabilitats del Na+ i del Cl- són 10-9 m/s i 10-8 m/s respectivament, calculeu el potencial de difusió. Discutiu la cinètica del procés. Indiqueu com canviarien els resultats anteriors si les permeabilitats dels ions estiguessin intercanviades.

  59.  

     

    Solució: a) -40.8 mV, b) 40.8 mV.

  60. La membrana plasmàtica d'una cèl.lula nerviosa (20o) té una permeabilitat de 10-7 cm/s pels ions de K+ i de 10-8 pels ions de Na+ i de Cl-. La concentració d'aquests ions al líquid extracel.lular és 4 mM pel K+, 150 mM pel Na+ i 120 mM pel Cl-. La concentració al citosol és 140 mM pel K+, 12 mM pel Na+ i 4 mM pel Cl-. a) Calculeu el potencial de membrana, b) indiqueu sobre un dibuix el sentit del camp elèctric i els sentits i les magnituds relatives dels fluxos de difusió, elèctric i d'electrodifusió per cada ió, c) indiqueu per quins ions existeix bombeig iònic i calculeu l'energia necessària per bombar un mol.

  61.  

     

    Solució: a) -52.1 mV, c) 3.6 kJ/mol, 11.2 kJ/mol, 3.2 kJ/mol.

  62. Com es modifica el potencial de membrana del problema anterior si: a) la concentració de K+ al líquid extracel.lular augmenta en un factor 2, b) la permeabilitat de la membrana al K+ augmenta un factor 200, c) la permeabilitat de la membrana al Na+ augmenta un factor 200.

  63.  

     

    Solució: a) -47.4 mV, b) -89.1 mV, c) 51.3 mV.

  64. L'axó d'una neurona sense mielina té un diàmetre de 10 m m i presenta les següents característiques elèctriques: resistivitat de l'axoplasma d 0 = 2 W .m, capacitat per unitat d'àrea de membrana Cm=10-2 F·m-2, resistència de pèrdua per unitat d'àrea de membrana Rm = 0.2 W .m2 .Calculeu: a) la resistència de l'axoplasma d'un segment d'axó d'1 cm de longitud, b) la resistència de pèrdua de la membrana d'un segment d'axò d'1 cm de longitud, c) la constant de longitud de l'axó (distància a la que la resistència de pèrdua a través de la membrana de l'axó és igual a la resistència de l'axoplasma.).

  65.  

     

    Solució: a) 2.55 · 108 W , b) 6.37 · 105 W , c) 0.5 mm.

  66. L'axó d'una neurona mielinitzada té un diàmetre de 10 m m i presenta les següents característiques elèctriques: ressistivitat de l'axoplasma d a= 2 W . m, capacitat per unitat d'àrea de membrana Cm=5·10-5 F m-2, resistència de pèrdua per unitat d'àrea de membrana

  67.  

     

    Rm = 40 W ·m2 . Calculeu: a) la resistència de l'axoplasma d'un segment d'axó d'1 cm de longitud, b) la resistència de pèrdua de la membrana d'un segment d'axò d'1 cm de longitud, c) la constant de longitud de l'axó.

    Solució: a) 2.55 ·108 W , b) 1.27 · 108 W , c) 7 mm.

  68. L'axó d'una neurona sense mielina té un diàmetre de 10 m m i presenta les següents característiques elèctriques: ressistivitat de l'axoplasma d a = 2 W .m, capacitat per unitat d'àrea de membrana Cm=10-2 F·m-2, resistència de pèrdua per unitat d'àrea de membrana

  69.  

     

    Rm = 0.2W · m2 . Calculeu la càrrega acumulada a la membrana d'un segment d'axó d'1 mm quan el potencial de membrana és -70 mV. Compareu aquesta càrrega amb la càrrega total de K+ dins d'aquest segment d'axó si la concentració de K+ del citosol és 140 mM.

    Solució: a) 2.2 · 10-11 C, b) 2 · 10-5.
     
     

    TEMA VI. COMUNICACIO CEL.LULAR. TRANSDUCCIÓ DE SENYALS. PROLIFERACIO , DIFERENCIACIO CEL.LULAR I APOPTOSI
     
     
     
     

  70. La pubertat precoç masculina és una malaltia hereditària autosòmica dominant. En aquests malalts s´han trobat mutacions en el receptor de la hormona luteïnitzant (LH). La figura A correspon a un gel de seqüenciació de DNA fet pel mètode del didesoxinucleòtid d´un fragment de la cadena codificant d´un axó del gen prèviament amplificat per PCR. En aquest gel es comparen les seqüències d´una persona normal i un malalt amb una mutació.

  71.  

     

    Dedueix la seqüència d´aminoàcids codificada pel fragment del gen normal i del gen mutat.

    En la figura B es mostra un esquema del receptor de la hormona luteïnitzant on es marca la posició del aminoàcids 576 a 581 i en la figura C es mostra l´efecte de la incubació de cèl.lules que tenen el receptor normal i el receptor mutat amb diferents concentracions de l´hormona LH sobre els nivells de AMP cíclic. Comenta els resultats obtinguts i proposa una explicació.
     
     

  72. La següent figura correspon a la estructura d´un receptor de membrana d´un factor de creixement.

  73.  

     

    a) Explica per què aquestes proteïnes experimenten fàcilment moviments laterals a la membrana però roten amb molta menys freqüència.

    b) Utilitza l´esquema ( si és pertinent ) per explicar i raonar on podrien produir-se 2 mutacions puntuals ( substitució d´una base per una altre ) en el gen del receptor amb les següents conseqüències:

    -El receptor està sempre actiu

    -No es detecta el receptor a la membrana plasmàtica. Experimentalment s´observa que el gen és transcrit i que els nivells de mRNA son normals.

    c) Suposem que el receptor té un mecanisme d´acció via AMP cíclic. Comenta en quin punt de la via de transducció de senyals existiria un defecte de funcionament si observem el següent:

    -Falla el control de la transcripció d´alguns gens pel senyal

    - el control pel senyal d´enzims claus del metabolisme per fosforilació/ defosforilació funciona perfectament

  74. En l´estudi del mecanisme d´acció d´un mitògen s´han obtingut els següents resultats:

  75.  

     

    a) El mitògen produeix un augment de la concentració de AMP cíclic

    b) No s´activa la fosfolipasa C

    c) S´activa l´expressió dels gens que tenen un element de resposta a cAMP

    d) Per produir l´acció a) es requereix GTP

    D´acord amb aquests resultats, dibuixa un esquema que expliqui els resultats obtinguts
     
     
     
     

  76. En l´estudi del mecanisme d´acció d´una hormona s´han obtingut els següents resultats:

  77.  

     

    a) L´hormona produeix un augment de la concentració de AMP cíclic

    b) Augmenta la concentració del calci citosòlic

    c) No s´activa la PKC

    d) No augmenta la concentració de Diacilglicerol

    e) No augmenta la concentració de inositol trifosfat

    f) S´activa l´expressió dels gens que tenen un element de resposta a cAMP

    Per produir les accions a,b i f es requereix GTP

    D´acord amb aquests resultats, dibuixa un esquema que expliqui els resultats obtinguts

  78. Fes un esquema d´un hipotètic mecanisme d´acció del receptor d´un senyal extracel.lular amb les següents premisses:

  79.  

     

    a) El senyal produeix un augment de la ceramida intracel.lular

    b) Augmenta la concentració de calci intracel.lular

    c) No es modifica la concentració de cap nucleòtid cíclic

    d) No es modifica la concentració intracel.lular de diacilglicerol

    e) No intervé el reticle endoplasmàtic

    f) Es fosforilen residus de serina en algunes proteïnes

    g) S´activa la transcripció d´alguns gens

    h) Per desenvolupar les accions a), b), f) i g) es requereix GTP

    i) Els inhibidors de la calmodulina no bloquejen l´acció g)
     
     

  80. En l´estudi del mecanisme d´acció d´una hormona, s´han obtingut els següents resultats:

  81.  

     

    a) La hormona produeix un augment del calci citosòlic

    b) No es modifica la concentració de AMP cíclic

    c) Indueix la fosforilació de residus de tirosina en algunes proteïnes

    d) per desenvolupar les accions a i c no requereix GTP

    e) s´activa la transcripció d´alguns gens

    f) L´acció e pot ser bloquejada per inhibidors de la calmodulina.

    g) D´acord amb aquests resultats, dibuixa un esquema que expliqui els resultats obtinguts

  82. En l´estudi del mecanisme d´acció d´una hormona, s´han obtingut els següents resultats:
    1. La hormona no produeix un augment del calci citosòlic
  1. No es modifica la concentració de AMP cíclic
  2. Indueix la fosforilació de residus de serina i treonina en algunes proteïnes
  3. La hormona indueix un augment de la concentració de diacilglicerol
  4. Per desenvolupar les accions c i d es requereix GTP
  5. D´acord amb aquests resultats, dibuixa un esquema que expliqui els resultats obtinguts
  1. Senyala i corregeix raonadament els errors que contenen el següents esquemes de transducció de senyals.
  2. Bcl-2 és un oncogen que codifica per a una proteïna inhibidora de l´apoptosi. Els nivells
d´ aquesta poteïna estan augmentats en alguns tipus de leucèmia, sense que estiguin afectats els nivells de mRNA. Proposa dos mecanismes que expliquin aquestes dades

116. c-fos és un proto-oncogen que codifica per un factor de transcripció implicat en la proliferació cel.lular. Fos es torna oncogènic quan augmenten els nivells de la proteïna que codifica. Raona tres llocs diferents del gen per produir-se mutacions amb l´efecte descrit però que no modifiquin la velocitat de transcripció del gen.